SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.H02901.1|PACid:23592218 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.H02901.1|PACid:23592218
Domain Number 1 Region: 229-330
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.51e-25
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 16-108
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-21
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H02901.1|PACid:23592218
Sequence length 343
Sequence
MSQEEERVAANGRRACIFYRLMVDSLIHEKQLGIPKKFARKYGDELSDVVRLVASDSSIW
LVELRKHGSRLWLHDGWQRFLEHHSIHSGHFLIFKYEGDSTFHVYVYNLTASWERNSHNP
LGSKEFISSRQFPMHTKKNQDTDSVVEIRDLCCACPICSCLKDKCFQECRGWRTTDRIHD
GVNIIRPEPVADWEVFHQDKGASYGKSSRECNAAIIEARGMAIRAAHTYEPNNPFFQVIM
RPSYVREKFLVNLPASFIGMHLKGDSRDITLQVSDGKKWRVRCLLFNGKGKISKGWREFV
ADNKLEIGDVCIFELLQREDIVLKVTIFRVPEIGQKYIATLTN
Download sequence
Identical sequences A0A059B1Q4
Eucgr.H02901.1|PACid:23592218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]