SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.H03197.1|PACid:23592506 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.H03197.1|PACid:23592506
Domain Number 1 Region: 200-475
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 2.11e-77
Family Cytokinin dehydrogenase 1 0.000000514
Further Details:      
 
Domain Number 2 Region: 3-198
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 5.61e-41
Family FAD-linked oxidases, N-terminal domain 0.00000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H03197.1|PACid:23592506
Sequence length 487
Sequence
DKLHVDPESIGEASVDFGLIVREIPVAVLRPSHPEDIAILVAFAYNKFPIPFTISARGCG
HSVRGQAMARDGVVVDMTSLGNKTTVSWSQSLGHYADVGGQQLWIDVLEETLKHGVAPVS
WTDYLYLTVGGTLSNAGISGGTFRYGPQISNVYEMDVITGTGHFLTCSPHENPELFHSVL
GGLGQFGIITRARIALGPAPKRAKWVKMLYSDFSAFTTDQERLISRHRRDQDEVLDYVEG
QLFMRRNSDSWISFFSSLDHPRLMSLVTEHELLYCIEVAKFYDECTQSAVDKDLEKILKD
LSHGPEFLYQKDVGYVDFLNRVRVGEMVLREQGLWNVPHPWLNLFVPKSRIADFNTGVFK
NIVLKKNMTTELVLIYPMNNDKWDDRMSAVIPDEDVFYAVGFLHSSGFEDWQEFDLQNKE
VLHFCEDNGIKQYLPNYSTESDWIQHFGPKWRKFEENKAQFDPKMLLSPGQNIFNHNQGM
NSKIDGV
Download sequence
Identical sequences A0A059B4A4
Eucgr.H03197.1|PACid:23592506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]