SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.H03198.1|PACid:23592507 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.H03198.1|PACid:23592507
Domain Number 1 Region: 266-543
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 2.62e-82
Family Cytokinin dehydrogenase 1 0.000000308
Further Details:      
 
Domain Number 2 Region: 77-264
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 9.81e-36
Family FAD-linked oxidases, N-terminal domain 0.00000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H03198.1|PACid:23592507
Sequence length 545
Sequence
HGIAIVSVCVFINETLGSSPPQLHHKHRNTSTCSSSLCSSNVKMAQNHQMASRCMLLSSE
RLTNSLYHKLLSLPIADKLHVDPESIGEASVDFGLIVREIPAAVLRPSHPEDIAILVAFA
YTRGCGHSVRGQAMARDGVVVDMTSLGNKTTVSWSQSLGHYADVGGQQLWIDVLEETLKH
GVAPVSWTDYLYLTVGGTLSNAGISGETFRYGPQISNAYEMDVITGTGHFLTCSPHENPE
LFHSVLGGLGQFVIITRARIALGPAPKRAKWVRMLYSDFSAFTMDQERLISVHGRDQDEA
LDYVEGQLFIRGNSDSWISFFSLSDHPRLMSLLTEHELLYCIEVAKFYDERTRSTVDKDL
KMILKDLSHVPEFLFQKDVGYVDFLNRVRAEEMTLRKLGLWNVPHPWLNLFVPKSRIADF
NTGVFKNIVLRKNITTGPVLIYPMNNDKWDDRMSAVIPDEDVFYTVGFLLSSGFKDWQEF
DLQNKEVLLFCEDNGIKVKQYLPNYSTEREWMQHFGPKWRAFQESKAQFDPKMLLSPGQR
IFNQN
Download sequence
Identical sequences A0A059B3N0
Eucgr.H03198.1|PACid:23592507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]