SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.H03393.1|PACid:23592699 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.H03393.1|PACid:23592699
Domain Number 1 Region: 243-474
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 1.5e-58
Family Cytokinin dehydrogenase 1 0.00000137
Further Details:      
 
Domain Number 2 Region: 46-239
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.48e-40
Family FAD-linked oxidases, N-terminal domain 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H03393.1|PACid:23592699
Sequence length 474
Sequence
MAQNHPVVSHCMAITLILMSTLVCQSKLLNDPLYRELLSLPIASDLHIDPESIAEASVDF
GLIVRKIPAVVLRPSHPEDIAVLVAFANSKSSIPFTISARGCGHSVRGQAMARDGVVVDM
TSLGNKTAVSWSQSLGHYADVGGQQLWINVLEETLKHGVTPVSWTDYLYLTVGGTLSNAG
ISGETFRYGPQISNVYEMDVITGTGHFFTCSPHKNPELFYSVLGGLGQFGIITRARIALG
QAPNRAIWVRMLYSDFSAFTTDQERLISLHGRDQDEALDYVEGQLFMRRNSDSWISFFSL
SDRPRLMSLLTEHELLYCIEVAKFYDERTRSTVDKDLKTILKDLSHVPEFLFQKDVGYVD
FLNRVRAEELTLRELGLWNVPHPWLNLFVPKSRIADFNTGVFKNIVLRKNITTGPVLIYP
MNNDKWDDRMSAVIPDEDVFYTVGFLLSSGFKDWQEFDLQNKEVLLFCEDNGIK
Download sequence
Identical sequences A0A059B3R3
Eucgr.H03393.1|PACid:23592699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]