SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.I02388.1|PACid:23597146 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.I02388.1|PACid:23597146
Domain Number 1 Region: 99-309
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.92e-65
Family FAD-linked oxidases, N-terminal domain 0.0043
Further Details:      
 
Domain Number 2 Region: 314-554
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 1.23e-51
Family Vanillyl-alcohol oxidase-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.I02388.1|PACid:23597146
Sequence length 599
Sequence
MKMDRWRASARRILKLSSRPDRAPRSAPDRGNPARYGSLHCSGRSCRGTQFYFGHQQPLS
VHLREREFASGASFIQSRWFGSMATKIQRNPKFATINSDDIRYFTDLLGDKNVIQDEDAL
LAANMDWMRKYKGSSKLLLLPRSTEEVSQILKYCNSRCLAVVPQGGNTGLVGGSVPVFDE
VIVNLGSMNKVLSFDEVSGILVSEAGCILESLVNFLDSKGFIMPLDLGAKGSCQIGGNVS
TNAGGLRLLRYGSLHANVLGLEAVLANGDVLDMLGTLRKDNTGYDLKHLFIGSEGSLGIV
TKVSILTPPKLSSVNVAFLACTDYLSCQKLLLEARRKLGEVLSAFEFLDEQAMDLALNHL
EGVRNPLPALHKFYVLIETTGSDERSDREKLEAFLVHSMEEGLISDGVVAQDIQQASSVW
NIREGIPEALMKAGAVYKYDLSIPVEKIYDIVEEMRNKLGHSARVVGYGHLGDGNLHLNI
SCPQYDDAVLAQIEPFVYEWTSKHRGSISAEHGLGLMKADKIFYSKSPAAVQLMASVKNL
LDPNHILNPYKQLQELIEHNLMVKSNAIVGKWSSSPCRYQSEHWLSSLGDVIQHLISAI
Download sequence
Identical sequences A0A059AS61
Eucgr.I02388.1|PACid:23597146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]