SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.I02389.3|PACid:23597149 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.I02389.3|PACid:23597149
Domain Number 1 Region: 51-261
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 9.35e-66
Family FAD-linked oxidases, N-terminal domain 0.0041
Further Details:      
 
Domain Number 2 Region: 236-475
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 3.43e-44
Family D-lactate dehydrogenase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.I02389.3|PACid:23597149
Sequence length 493
Sequence
MKMDGWRASARRILKLSSRPAPAPRFAPGRGNPARHGTIQRNPEFATINSDDISYFRDLL
GEKNVIQDEDALLAANMDWMRKYKGSSKLLLLPRSTEEVSQVLKYCNSRCLAVVPQGGNT
GLVGGSVPVFDEVIVNLGSMNKVISFDEVSGILVSEAGCILESLVNFLDNNGFIMPLDLG
SKGSCQIGGNVSTNAGGLRLIRYGSLHANVLGLEAVLANGDVLDMLGTLRKDNTGYDLKH
LFIGSEGSLGIVTKVSILTPPKLSSVNVAFLACTDYLSCQKLLLEARRKLGEVLSAFEFL
DEQAMDLALNHLEGVRNPLPPALHKFYVLIETTGSDERSDREKLEAFLAHSMEEGLISDG
VVAQDIQQASSVWNIREGIAEALMKAGAVYKYDLSIPVEKIYDIVEELRNKLGHLARVVG
FGHLGDGNLHLNISCPQYDDAVLAQIEPFVYEWTSKHGGSISAEHGLGLMKADKIFYSKS
PAAVKLAGPQSHT
Download sequence
Identical sequences A0A059ASM5
Eucgr.I02389.3|PACid:23597149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]