SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.J00347.1|PACid:23598094 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.J00347.1|PACid:23598094
Domain Number 1 Region: 245-371
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 1.67e-36
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0000163
Further Details:      
 
Domain Number 2 Region: 143-244
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.27e-31
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.J00347.1|PACid:23598094
Sequence length 375
Sequence
MASHGEDHGRHANPAAAAKANSTTTKFAKNGHVTKFGPSDGPESATSPPPPEILRQSTAL
PRKSPPIRRPLSSSSSSALLLPARSNGDRNLEARDRDLEGAHAVAGGGGGGVFGGGAPPP
RPVPRERGRGAAVEPKAKPTTSLKTFSIYRWTPDSPSKPKLKDYQIDLKECGPMVLDALI
KIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKIPDGADASTITPLPHMFVIKD
LVVDMTNFYNQYKSIEPWLKRKNPPSEPGKEILQSKKDRAKLDGMYECILCACCSTSCPS
YWWNPESYLGPAALLHANRWIMDSRDEFTKERLDAINDEFKLYRCHTILNCARACPKGLN
PGKQIINIKQLELAK
Download sequence
Identical sequences A0A059A9Y4
Eucgr.J00347.1|PACid:23598094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]