SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.J00610.1|PACid:23598413 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.J00610.1|PACid:23598413
Domain Number 1 Region: 730-1353
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 3.14e-152
Family Molybdenum cofactor-binding domain 0.00000000675
Further Details:      
 
Domain Number 2 Region: 205-424
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.45e-38
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.00097
Further Details:      
 
Domain Number 3 Region: 592-726
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 9.68e-32
Family CO dehydrogenase molybdoprotein N-domain-like 0.00027
Further Details:      
 
Domain Number 4 Region: 108-225
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 3.66e-28
Family CO dehydrogenase ISP C-domain like 0.00033
Further Details:      
 
Domain Number 5 Region: 15-101
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 9.03e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00036
Further Details:      
 
Domain Number 6 Region: 439-549
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 0.0000000000034
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.J00610.1|PACid:23598413
Sequence length 1371
Sequence
MEGREAAAAASGGALVFAVNGERFEVSGVEPSTTLLEFLRTRTRFRSVKLGCGEGGCGAC
VVLLSRYDPVLDQVEDITASSCLTLLCSVNRCSVTTTEGLGNSRDGFHPIHQRFSGFHAS
QCGFCTPGMCISLYGAIVNAEKTDRPEPPPGFSKLSVFESEKAIVGNLCRCTGYRPIADA
CKSFAADVDLEDLGLNSFWRKGDSKEFKMSRLPPYRCKDENCTFPEFLKKEIKSSMLLDT
KSYDWHTPTTVEDLQCLLETDGNSDASLIKLVSGNTGMGYYKEVKRWEKYIDLRNIPELA
IVKADETGIEFGTTVTISKAIEALREHSKCMSSTEGGMIFRKTADHLEKIASGFIRNTAS
LGGNLVMAQRFHFPSDIATVLLAVDSQVTVMLGPKQERLTMEEFLERSPLDSRSVLLSIK
IPTWHLRRSTASEATKRLLFETYRAAPRPLGNALPYLNAAFLAEVTVSEALHEIVINNCR
LTFGAYGTQHAIRARKVEEALTGKVLSLSVLREAIEVVKATIVADYGTRDPAYRSSLAVG
FVFKFLSPLIESRAKTVNNSLNGYNSAILAGEPNLTQDCSQISSLLSSSSQVFELNKEHY
PVGEPIKKSEAAIQASGEAVYVDDIPSPANCLYGAFIYSTKPLARVEGIRIPSSVPSNFI
SSIISFQDIPDGGQNVGSSTIFGLEPLFADELAHCAGQPIALVVADTQKHADMAADSAVV
DYDVDNLETPILSLEEAVERSSFLEVPSFLYPDEVGDLSKGMAEADNKILSAKIELGSQY
YFYMENQTALAVPDEDNCMVVYSSIQCPEYAHNTIATCLGILGHNVRVITRRVGGGFGGK
AIKAMPVATACALAAYKLRRPVRTYLNRKTDMIMAGGRHPMKVTYSVGFKSNGKITALRL
DILINGGTTADISPVMPMNIVGALKKYDWGALSFDIKVCKTNHTSKSAMRAPGDVQGTFI
AEAVIEHVASALSMNVDSVRDINLHTHSSLSLFYKHAAGEPQEYTVPSIWTKLALSSNMD
QRIEMAKEFNRCSLWKKRGISRVPILFEVSLRATPGKVSILNDGSIVVEVGGIEIGQGLW
TKVKQMVAFALSSVQCDGTTELLEKIRVIQADTLSLIQGGFTAGSTTSEASCQAARVCCD
ILVQRLSPLKNSLQEQMGSVTWEVLVGQAYQQSINLSASTYYAPELGSMQYLNYGAAVSE
VEVDLLTGETRILRVDIIYDCGKSLNPAIDLGQIEGAFVQGLGFFMLEEYLTNSEGLVVA
EGTWTYKIPTLDTIPKEFNVEILNSGHHQKRVLSSKASGEPPLLLAVSIHCAARAAIKEA
RKQLHSWSGHDECNSIFQLGVPATMPVVKGLCGLNSVESYLDWRLGKEQKA
Download sequence
Identical sequences A0A059ABH8
XP_018719700.1.83385 Eucgr.J00610.1|PACid:23598413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]