SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.J00780.2|PACid:23598625 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.J00780.2|PACid:23598625
Domain Number 1 Region: 615-1240
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 8.11e-183
Family Molybdenum cofactor-binding domain 0.00000000000806
Further Details:      
 
Domain Number 2 Region: 132-336
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.62e-58
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.00000938
Further Details:      
 
Domain Number 3 Region: 475-616
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 2.88e-40
Family CO dehydrogenase molybdoprotein N-domain-like 0.0000566
Further Details:      
 
Domain Number 4 Region: 340-453
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 2.62e-33
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0000832
Further Details:      
 
Domain Number 5 Region: 3-69
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 3.14e-27
Family CO dehydrogenase ISP C-domain like 0.0000969
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.J00780.2|PACid:23598625
Sequence length 1257
Sequence
MSESLARAHGSQCGFCTPGFIMSMYALLRSSQSPPPEEQIDECLSGNLCRCTGYRPILDA
FRVFAKTENSLYGPQPSSSSVEESNVVCPSTGKPCSCRSGSLVDSEPTRESICCGQKYKA
ISYDEVDGSLYAEKELIFPPELLLRKISYLSLSGFNGLKWYRPSRLKQVLELKSRYPDAK
LLVGNTEVGIEMRLKRMHYPVLISTMHVPELNVLDVKDDGVEIGAAVRLSDLLTVFRKVV
TERAYHETSTCKAFIEQLKWFAGTQIKNVASVGGNICTASPISDLNPLWMASRAKFRVID
GKGNLRIVSAENFFLGYRKVDLASGEILLSVFLPWSRSLEYVKEFKQAHRRDDDIAIVNA
GMRVFLEKKDDNLVVADASIVYGGVAPLSIAARQTKEYLIGRTWNQELLQGALEVLRSDI
LIKENAPGGMVEFRRSLILSFFFKFFLWVSHEMDGMRSIKEEIPLSHISAIKPFERPSVI
GCQDYEIVKRGTAVGSPEVHLSARLQVTGEAEYADDIALPPNGLNAALVLSRKPHARIIS
VDDSQAKSSPGFAGIFLAKDVPRKNKIGHVINDEELFASEFVSCVGQVIGVVVADTQENA
KLAARKVHVEYEELPAIFSIEDAIKAKSFHPNTERFLGKGDVDLCFQSGECYKVIQGEVQ
VGGQEHFYLEPQSTVIWTVDGGNEVHMVSSTQAPQKHQKYVSGVLGLPMSKVVCRIKRLG
GGFGGKETRSAFLAAAASVPSYLLNRPVKITLDRDADMMITGQRHSFLGKYKVGFTKEGK
VLALDLEIYNNAGNSLDLSLAILEHAMFHSDNVYEIPNIRINGRVCFTNFPSNTAFRGFG
GPQGMLIAENWIQRIAVELKKSPEEIKEMNFQGEGSVLHYGQQLQHCKLGQLWNALKESC
NFLNARKEADQFNLQNRWKKRGVAMVPTKFGISFTTKLLNQAGALVQVYTDGTVLVTHGG
VEMGQGLHTKVAQVAASSFNIPLTSVFISETSTDKVPNASPTAASASSDMYGAAVLDACE
QIKARMEPIASRKNFSSFAELASACYVERIDLSAHGFHIVPEIGFDWKTGKGNPFRYHTY
GAAYAELEIDTLTGDFHTRDANVFLDLGYSINPAIDVGQIEGAFVQGLGWVALEELKWGD
AAHKWIPPGCLYTCGPGTYKIPSVNDVPLKFSVSLLKGHPNVKAIHSSKAVGEPPFFLAS
SVFFAIKDAIIAARADAGFTDWFPLDNPATPERIRMACLDEFTAPFVGSDFRPKLSV
Download sequence
Identical sequences A0A059ABS5
Eucgr.J00780.2|PACid:23598625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]