SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.J01272.1|PACid:23599242 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.J01272.1|PACid:23599242
Domain Number 1 Region: 19-209
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.82e-33
Family FAD-linked oxidases, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.J01272.1|PACid:23599242
Sequence length 561
Sequence
PPADPIRCTSSGCTITNSYGTFPDRSTCKAGAAAFPTSEEELVWVVGNATKSRRKMKVAT
HSSHSIPKLVCPDGEDGLLVSTKYMKRIVRVDRQGMRMSVEGGVTLRQLIEEAAKAGMAL
PYAPYWWGVTVGGMLGTGAHGSSLWGKGSALHDYVEAMRIVSPGRPGDGYAKIRTLDVNR
NSTRAEMDAVKVSLGVLGVISQVTLKLQPLFKRSLTYSIKGDLDLGEQATSFGKQHEFAD
IMWYPSQRKAVYRIDDRVTFNAVGSGLYDFTPFRSTPSLTLALVRSTEELQESLNDAEGK
CNSAKLVSSTLETIAYGLTNNGIIFTGYPVIGYHNKLQSSGTCLDSPQDGLITACPWDPR
VEGEFFYQTTFSVGLSMVKNFIKDIQQLIAFEPKALCGVELYNGILMRYVTASSAYLGKQ
EDAVDFDITYYKSKDPLSPRLYEDVLEEIEQMALFKYNALPHWGKNRNLAFDGVIKKYKK
AREFLKVKEMYDPLGLFSSEWTDQVLGLKEGVSIVRDGCALEGLCICSQDAHCAPKKGYY
CRSGKVYKEAKVCTRINSKMR
Download sequence
Identical sequences A0A059ACK3
Eucgr.J01272.1|PACid:23599242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]