SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.J01637.2|PACid:23599626 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.J01637.2|PACid:23599626
Domain Number 1 Region: 57-178
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.29e-30
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.J01637.2|PACid:23599626
Sequence length 206
Sequence
MGLGLLASRALRPAASRLLRDPPRHGLAWAIGSTPERQSPEASAGARFHLPNPENAIEVF
VDGYPVKIPQGMTVLQACEVAGVDTPRFCYHSRLSIADNCRMCLVKVEKSLKPVASCAMP
ALPGMKIKTDPPIAKKAREGVMEFLLMNHPLDCPICDQGGECDLQDQSMAFGSDQGRFTE
LKRSVVHKNLGPLVKTVMTRCIQCTR
Download sequence
Identical sequences A0A059AEM7
Eucgr.J01637.2|PACid:23599626 XP_018720021.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]