SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.J02177.1|PACid:23600256 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.J02177.1|PACid:23600256
Domain Number 1 Region: 151-274
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.15e-30
Family Ribonuclease H 0.0026
Further Details:      
 
Domain Number 2 Region: 9-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.0000628
Family N-terminal domain of RNase HI 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.J02177.1|PACid:23600256
Sequence length 332
Sequence
MSKKGGADAFYVVRKGDLIGIYKTLKDCQAQAGSSVHSPSVSVYKGHGLAEEAEEHLKSH
GLKNASYTISAADLKNDIFGELVPCPFQQPASTRGASLNKALPTKRSVEALQWDHKQAVG
PTSALINHQSKHLKLNDGTASQPASSNCSSCSLEFDGASKGNPGPAGAGAILRADDGSSV
WRLREGVGIATNNVAEYRALIMGLRQALQKGFKKIQVRGDSMLVCMQIQGKWKLKNQNMA
DLCQVAKELKDRFTTFQIDHVRREFNSEADAQANLAIALKDGQVEGDVDSNSSSMEPSAA
SCCALRLFWKRERERELHSLLGTCIATGKELH
Download sequence
Identical sequences A0A059AGG7
Eucgr.J02177.1|PACid:23600256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]