SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.K01123.1|PACid:23602599 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.K01123.1|PACid:23602599
Domain Number 1 Region: 154-235
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000608
Family B3 DNA binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.K01123.1|PACid:23602599
Sequence length 238
Sequence
MSSGSGRNSRRSSDSELEEGEIRDTPSPGDDHQEPGELGKGEIVRRDAPSPDDREGYSGR
VEIGSKANTMSLDILTIAATASREEARRSQESSAAASSSSEDPSALRERVRRSFFPGVAT
SDMIEGCEMVLLVEKPLDIMDAQLQAKFLRKAEKEVLKTRDENGAQTEMKVLLLGPSGET
CHLRLIRLDLKNKSETVYHLVGQGWVDIVARNGLEKDQVVRLYCCRIASNLCFALVCP
Download sequence
Identical sequences A0A059A1Y2
Eucgr.K01123.1|PACid:23602599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]