SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.K01240.1|PACid:23602718 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.K01240.1|PACid:23602718
Domain Number 1 Region: 115-224
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.88e-29
Family B3 DNA binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  Eucgr.K01240.1|PACid:23602718
Domain Number - Region: 624-695
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0206
Family PB1 domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.K01240.1|PACid:23602718
Sequence length 707
Sequence
MITFIDSKEKLKEVEKTLDSQLWHACAGGMVQMPPVNSKVFYFPQGHAEHSSGPVDFRSC
PRIPAYIPCRVSAIRFMADPETDEVFAKMRLVPLTSSEPDFGDDGIGGLQGSDGQDKPAS
FAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSVDPPVQTILAKDVHGETWKFRHIYRGT
PRRHLLTTGWSTFVNHKKLVAGDSIVFMRAENGDLCVGIRRAKRGIGSGPESSSGWNPVG
GNCAVPYGGFSAFLTEDENKLITNGHGNCMSGNGSLMGKKRVTPEAVVEAASLAANGHPF
EVVYYPRASTPEFCVKSSLVKTAMQIRWCPGMRFKMAFETEDSSRISWFMGTISSVHVAD
PTCWPDSPWRLLQVTWDEPDLLQNVKRVSPWLVELVSSMPAIHLSPFSPPRKKLRLPHHP
DFPLDGHFPMPSFSGDLLGPSSPFGCLPNSHSAAGMQGARHAYYSQSLPDLHLSKQPSSL
FPAGFPLLDHSIRSMRTSNGPRMHKSSSDDDISTLLTMTNYGKVFKKLEEVKKPPQLVLF
GKPILTEQQISLSNSATTTTTTASPVRTSSEEKIDKTGSFPDGPDSARQQSGQREQQSSC
EQLRVHEDKHQQEMEACSEIGHCKVFIASEDVGRTLDLSLLASYDELCRKLTDMFGVENS
QSLARHVLYRDDKGAEKRIGDEPYSDFIRTARRLTILTNSSSNGVGS
Download sequence
Identical sequences A0A059A1B4
XP_010035948.1.83385 Eucgr.K01240.1|PACid:23602718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]