SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.K02197.2|PACid:23603734 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.K02197.2|PACid:23603734
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-20
Family B3 DNA binding domain 0.0027
Further Details:      
 
Domain Number 2 Region: 540-617
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000378
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.K02197.2|PACid:23603734
Sequence length 666
Sequence
MSKQPPTQELAAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGE
NGELRVGVRRAMKQQGNVSPSVISSHSMHLGVLATAWHAISTGTMFTVYYKPRISPAEFI
IPYDQYMESLKKNYSIGMRFKMRFEGEEAPEQRFTGTIIGIEDADPKGWRDTKWRSLKVR
WDENSAIPRPERVSPWNVEPALAPLALNPLPVSRPKRPRSSILPSSPESSVLTREVAADP
SSSNGHSRILQGPESSTLRGIATDNDFDVVEKSVMFTPSMEEEKIDMLSASKRHGLDSWM
TSGRRGPTCADLLSGFGGNTDVSHGFSLSSEQSSAANPARKHLVDQGRKFHIIGNSWSMI
PSSLSLNLSESNRNSSLHGNDMHSPQGIGKYSGSKEYPVVHGQRVEQPHQNWVMRPPMSP
HFNFPHASESISKSPYAQQHEAIKAKGGNCKLFGIPLVSNPVMAKSAVSVRSATNVFTDH
VDSPSCQAHGFRLDQPMEPLNAANGGDDLVANELEKEKLFQNSQPHNRDVHHRVQASSTR
SCTKVQKQGIALGRSVDLAKFSNYDELRAELDQLFEFGGELMNPRSNWLIVYNDDEGDMM
LVGDDPWQEFCGIVRKIFIYTREEVQKMKPGTISAKDEDNLMVDEGVFSKKMTSDTLPSA
SDPKNC
Download sequence
Identical sequences A0A059A598
Eucgr.K02197.2|PACid:23603734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]