SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.K02197.3|PACid:23603735 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.K02197.3|PACid:23603735
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-20
Family B3 DNA binding domain 0.0027
Further Details:      
 
Domain Number 2 Region: 539-616
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000373
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.K02197.3|PACid:23603735
Sequence length 665
Sequence
MSKQPPTQELAAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGE
NGELRVGVRRAMKQQGNVSPSVISSHSMHLGVLATAWHAISTGTMFTVYYKPRISPAEFI
IPYDQYMESLKKNYSIGMRFKMRFEGEEAPEQRFTGTIIGIEDADPKGWRDTKWRSLKVR
WDENSAIPRPERVSPWNVEPALAPLALNPLPVSRPKRPRSSILPSSPESSVLTREAADPS
SSNGHSRILQGPESSTLRGIATDNDFDVVEKSVMFTPSMEEEKIDMLSASKRHGLDSWMT
SGRRGPTCADLLSGFGGNTDVSHGFSLSSEQSSAANPARKHLVDQGRKFHIIGNSWSMIP
SSLSLNLSESNRNSSLHGNDMHSPQGIGKYSGSKEYPVVHGQRVEQPHQNWVMRPPMSPH
FNFPHASESISKSPYAQQHEAIKAKGGNCKLFGIPLVSNPVMAKSAVSVRSATNVFTDHV
DSPSCQAHGFRLDQPMEPLNAANGGDDLVANELEKEKLFQNSQPHNRDVHHRVQASSTRS
CTKVQKQGIALGRSVDLAKFSNYDELRAELDQLFEFGGELMNPRSNWLIVYNDDEGDMML
VGDDPWQEFCGIVRKIFIYTREEVQKMKPGTISAKDEDNLMVDEGVFSKKMTSDTLPSAS
DPKNC
Download sequence
Identical sequences A0A059A345
Eucgr.K02197.3|PACid:23603735 Eucgr.K02197.4|PACid:23603736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]