SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.K03006.1|PACid:23604689 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.K03006.1|PACid:23604689
Domain Number 1 Region: 115-232
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 5.49e-18
Family N-utilization substance G protein NusG, N-terminal domain 0.0023
Further Details:      
 
Domain Number 2 Region: 297-346
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000000105
Family N-utilization substance G protein NusG, C-terminal domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.K03006.1|PACid:23604689
Sequence length 351
Sequence
MKQGLLQWSPCNHLRPSLSSSFLLRSPIRIARVARRPPPPPPPAAAAVSAALEPPAGAEA
LTARERRQLRNQRRESRAAYNWREEVEERLIKKPKKRYASWTEELNLDTLAEPGPQWWIV
RVSRVRGQETADLIARSLIRNFPEVDFKVYAPAVQEKRKLKNGSYSVKARPLFPGCVFLR
CILNKELHDFIRECDGVGGFVGSKVGNTKRQINKPRPVSEDDMEAIFRKAKEEQEKTDRA
FEEEQVSEKLKSEKLDLDLHSSTDDSLESALKPKRKSRKSSSTVGGLSAKEKYKLLVPGS
TVRVLSGTFAGFEGSLKKLNRKNKKATIGFALFGKESLVDLDVDEIVPEVA
Download sequence
Identical sequences A0A059A760
XP_010037752.1.83385 XP_010037753.1.83385 Eucgr.K03006.1|PACid:23604689 Eucgr.K03006.2|PACid:23604690 Eucgr.K03006.3|PACid:23604691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]