SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.L01060.1|PACid:23606124 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.L01060.1|PACid:23606124
Domain Number 1 Region: 136-413
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 6.54e-79
Family Cytokinin dehydrogenase 1 0.00000049
Further Details:      
 
Domain Number 2 Region: 3-132
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3.55e-26
Family FAD-linked oxidases, N-terminal domain 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.L01060.1|PACid:23606124
Sequence length 415
Sequence
MAPDGVVVDMMSLENKRRGTTVLWSWSLGHYADVGGQQLWIDVLEETLKHGVAPVSWTDY
LYLTVGGTLSNAGISGETFRYGPQISNVYEMDVITGTGDFLTCSPDKNPELFYSVLGGLG
QFGIITRARIALGQAPKRVKWVRMLYSDFSDFTIDQESLISHHGRDQDEALDYVEGSLLM
HRNSDSWTSFFSLSDRQRLMSLVTEHELLYCIEVAKFYDGRTQTTVDKALEIILKDLSHV
PEFMFEKDVAYVDFLNRVRVEELKLRRQGLWNVPHPWLNLFVPKSRIADFNTGVFNNIVL
KKNITTGLVLIYPMNNDKWDDRMSAVIPDEDVFYTVGFLHSSGFEDWQEFDLQNKEVLLF
CENNGIKVKQYLPNYNTEREWMEHFGSKWRTFQESKAQFDPKMLLSPGQRIFNHN
Download sequence
Identical sequences A0A058ZTZ8
Eucgr.L01060.1|PACid:23606124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]