SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.L01673.1|PACid:23606585 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.L01673.1|PACid:23606585
Domain Number 1 Region: 192-299
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.93e-30
Family B3 DNA binding domain 0.0000197
Further Details:      
 
Domain Number 2 Region: 63-120
Classification Level Classification E-value
Superfamily DNA-binding domain 1.31e-16
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.L01673.1|PACid:23606585
Sequence length 337
Sequence
MDGNIICIDELSSTSDSNVIPLPSKSWQPPTPPQSLCRLGSGTSVTLDCEGGIKAESRKL
NPSKYKGVVPQPNGRWGAQIYEKHQRVWIGTFSEEDEAAMAYDIAAKCFRGQAAVTNFNQ
RSNTEDYDLEAAFLISHSKAEIVDMLREHAYYEELEQCKRKYVNANGDGKRVSMTEVLGD
PSGPGRAAAACHLLFQKEVMQSDVGNLNRFVIPKQHAEKHFPLHNRSSPTTSKGTLLTFI
DSGGKVWRFRYLYWNSSRSYVLTRGWSRFVKEKSLRAGDIISFHRSAGPEKQLHINYMRR
SGLSQARPVHPVQKVRLFGVDIFQVSGTGGGVNCGGR
Download sequence
Identical sequences A0A058ZSG9
Eucgr.L01673.1|PACid:23606585 XP_010040940.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]