SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Eucgr.L01961.1|PACid:23606799 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.L01961.1|PACid:23606799
Domain Number 1 Region: 27-203
Classification Level Classification E-value
Superfamily STI-like 5.42e-55
Family Kunitz (STI) inhibitors 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.L01961.1|PACid:23606799
Sequence length 203
Sequence
MDMKTPLSVLLLSLLLLSFSPKPSNAASSPVLDTDGHKLQTGVNYHILPVLRGRGGGLTL
GASRSGNCPLAVVQEQQELSDGLPAKFSPVDGRSTIRLSTDLNVWFDAATICVQSTVWRL
AAFDEEVKQYFVESGGVLGNPGRETVSNWFKIEKMDEDYNFRFCPTVCDTCKVICRDVGI
YVDGATRRLALSDEPFRVKFKKA
Download sequence
Identical sequences A0A058ZSX9
XP_010041215.1.83385 Eucgr.L01961.1|PACid:23606799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]