SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.L02133.1|PACid:23606924 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.L02133.1|PACid:23606924
Domain Number 1 Region: 82-158
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00000000000000524
Family 2Fe-2S ferredoxin-related 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.L02133.1|PACid:23606924
Sequence length 175
Sequence
MASLSFAAAAVVHLRRPDVASNFGNRQKPSKLVRGKRLALSLNATGSTGPSSAAPEKPEI
ELEFIGPKPGADGSYPVDKAKAVSGEKLLRNIMNENKIELYATYGKVMNCGGGGSCGTCI
VEIIDGKDLLNERTNTELRYLKKKPESWRLACQTIVGNKENSGKVAVQRLPQWKK
Download sequence
Identical sequences A0A058ZRI0
Eucgr.L02133.1|PACid:23606924 XP_010041387.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]