SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.L02216.1|PACid:23606980 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.L02216.1|PACid:23606980
Domain Number 1 Region: 7-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-27
Family B3 DNA binding domain 0.0015
Further Details:      
 
Domain Number 2 Region: 142-221
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000049
Family B3 DNA binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.L02216.1|PACid:23606980
Sequence length 223
Sequence
MVGGRHFESQTPHFFKIILSDALQNGRLGIPKKFVRKYGSNLSDLVFLQVPSGQAWEVEL
VRRTDGVWLRRGWPDFVKHYAIKHGHFLVFRYEGGSAFRVVIFDKSASEIKYPIITELPK
REENEGDTGGEKSEALKRAASFQSSNPFFLTLMQPSLICHSLRFWLARYKFGIYGRKTQV
KINSGWKLFVQDNNLKVGDICIFELLDSDLIVLKVSIFRYSID
Download sequence
Identical sequences A0A058ZRB6
Eucgr.L02216.1|PACid:23606980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]