SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.L02344.1|PACid:23607063 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.L02344.1|PACid:23607063
Domain Number 1 Region: 31-256
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.15e-43
Family FAD-linked oxidases, N-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.L02344.1|PACid:23607063
Sequence length 483
Sequence
MGTSFPNSKTLSLFSLQALFTASFSSPSTAFANETLSQCLISHSQASHPITSAILYTPAN
SSYSTVLQSYIRNLRFNSSDTPKPTLILTALHESHVQAAIVCARKLSVQMKIRSGGHDFE
GISYVSISSPFFILDMINFRSVDVDIETETAWVQAGAILGEVYYGIAAKSKVHGFPAGVC
PMVGIGGHLSGGGYGNMMRKYGLSVDNIVDACMINVKGKILDRESMGEDLFWAIRGGGGA
SFGVILAYKINLVHVPEMVTVFRIQRTREQNATAVVYQWEQVAHKLHEDLFIRLVMDVVA
GKNTGEKTVRARFIALFLGDAQRLLSMISDGFPELGLRSSDCIEMSWVESTLYWMNFPIG
TPVDALLSRAPKGLMHLKRKSDYVRHIISKDELELLWKRMIDLERPILTFNPYGGKMGKI
PTTETPFPHRAGNLWKVQYATNWHEEGHEAAQHNIELTRKLYNYMTPFVSKNPRAAFLNY
RDL
Download sequence
Identical sequences A0A058ZS97
Eucgr.L02344.1|PACid:23607063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]