SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.L02929.1|PACid:23607507 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.L02929.1|PACid:23607507
Domain Number 1 Region: 77-259
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 5.14e-48
Family FAD-linked oxidases, N-terminal domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.L02929.1|PACid:23607507
Sequence length 534
Sequence
MTPPSPSTPVSPLLLLLLFVLVSSSSASLYDTFLQCLLNHTQVLQQQQQQQQQEPSQILH
APTNSSFPTLLGSLIRNRRFGTSSTPKPLLILTPSQPSHVQSAVLCARRTGTEVRIRSGG
HDFEGTSYVSRAPFLILDMFNFRSVDVDVERETAWVGSGATIGELYYRIWEKSGLYGFNA
GVCPTVGVGGHLSGGGYGNMLRKYGLASDNVVDAQIVDVEGRVLDRSSMGEDLFWAIRGG
GGASFGVILGYRVKLVPVPNVVTVFRVAKTIQENATELVYQWQNAAPRTDNDLFMRLLLQ
PVSSKIQKGAKTVNASVLALFLGNADRLVSLVNEEFPELGLKKEDCAEMSWIESALWWGD
FDSGTAVEALLDRMPKSVNFLKRKSDYVQQPMSREELELLWDKMIELGKVGFVFNPYGGK
MGEIPMSDAPFPHRAGNLFKIQYSISWSEDGIEAEQSNLAEIRELYNFMTPYVSKKPRRA
FLNYRDLDIGITDNGENSYREGTVYGVKYFAENFKRLVKVKTAVDPQNFFRNEQ
Download sequence
Identical sequences Eucgr.L02929.1|PACid:23607507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]