SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.L03371.1|PACid:23607807 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Eucgr.L03371.1|PACid:23607807
Domain Number - Region: 206-232
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0051
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.L03371.1|PACid:23607807
Sequence length 232
Sequence
FKEPPVKNWNQLAGSGPVPWRQATALFNTSISRPDVLPRQPHDASTSNDRFGVGERYSIS
SMDNFSNRFMNGNMKLGPVEKLENGIAGPNSDEHLNPCKINPQQSTYVKEDPSTPPYGLA
VPHASGNEPNGHIGLVGPHYRPAPPPAKHYIGSMLNDTNSSGESHTRNGRPRGDARGRNQ
LLPRYWPRITDQELQQISGDSNSVITPLFEKMLSASDAGKIGRLVLPKKCAE
Download sequence
Identical sequences Eucgr.L03371.1|PACid:23607807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]