SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.L03694.1|PACid:23607997 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.L03694.1|PACid:23607997
Domain Number 1 Region: 144-253
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000051
Family B3 DNA binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.L03694.1|PACid:23607997
Sequence length 259
Sequence
MGSSSSRVSHLQDHEQKPVGDHLRSEVHSPPPSMDSSSCLSSLHDQEKDRDEGARGTSFA
GVVVSREFFSVAPNRTTKEVGGPSQEIVPAQLKRKSVALPTDAETLIVEKKAKCKRTQKG
KKEASGCDAEEVSTELTLLFDPYKIKKRLTQSDLGHLSRLLIGRDFVKSHFLRWMSEETV
RQVESGRGADVIVRDLDTCSEHRLVFVFWASSGSYVLKGGWIKEFVKRRGLAAGDEVGIY
WEPSASEFHFSLLHRANQA
Download sequence
Identical sequences XP_010042934.1.83385 Eucgr.L03694.1|PACid:23607997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]