SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.A00904.1|PACid:23562616 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.A00904.1|PACid:23562616
Domain Number 1 Region: 395-622
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000118
Family Tropomyosin 0.00043
Further Details:      
 
Domain Number 2 Region: 587-762
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000647
Family Tropomyosin 0.0018
Further Details:      
 
Weak hits

Sequence:  Eucgr.A00904.1|PACid:23562616
Domain Number - Region: 925-1072
Classification Level Classification E-value
Superfamily Adenylylcyclase toxin (the edema factor) 0.051
Family Adenylylcyclase toxin (the edema factor) 0.016
Further Details:      
 
Domain Number - Region: 1043-1131
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0732
Family Myosin rod fragments 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.A00904.1|PACid:23562616
Sequence length 1353
Sequence
MDEETTASPVVPVTKAIDESEINADLVKALNGDVPPAAKEGKKEEEETALDGEFIKVEKE
SFEGKDGHHMVESASSQHNTSSLERSSSNSVRELLETQEKMKELEIELERVVGALKHTES
ENIQLKDEVSETKEKLEISGKKYEELEHNHRKLQQHIIEAEEKYGLELSTLQQALQAQEA
KYKELINVKEDFDGLQLEHGHSRKRLLELEHELQCSAGEARKFEELHKESGSHAESQTKR
ALEFEQLLEVAKLSAKEKEDQMTSLQEEMKGLYDKIAENQKVEEALEKTTAELSAVQQEL
TLSKSQTLELEQRLSSKEGAITELMQELELIKASESQVKGDLTTLEDTFESVKDDLQAKV
KELEQIKLKLEEEMSMRGTFEGQFKAQEVQFLDVQEKLAKVATEKEAIEATVGDLNANVA
LMKDLCAELESKLKLSEDNNSKADSLLSQALSDNGELEQKLKSLEELHNASGEAAAAATQ
RNVELESIVQASTAAAEEAKAQMKELEARFIAAEQKSKELEEQLNLAVQKSSDAERELED
FAAKVSELTTTLRELEGGKEQQSTLIQEYQDKINQLEASLSHSSTRHSELEEELKSTVGK
CAEHEDRAKMTHQRSLELEDLIQISHSKAEDSGKRVSELELLLETEKYRIQELEDQINSL
EKKCAEAEADSKKFSDGASELASEVEAFQARSSSLEIALQTAQEKEKELTECLNVATEEK
KRLEDASSSSATKLAETESLLELLRDELGLTQQKLESIESDLKASGIRESEVLEKLRLAE
EQMEQQVKLLEQTTSKRSELESLHQSVTRDFELKLEEAMTSFSSRDSEAKSLFEKLKILE
DQAKGYEGQVAEASGKSASLKEELDQSVMKVALLEGTVEELRKQIVEAETLREELDQSVM
KVALLEGTVEELRKQIVEVENKASQSLSDNELLVETNVQLKNRVNELQESLNTAISEREA
TAQQLVSHVSDVNNLKDQHSRAIELHTASEARILEAEKQLQEAELRFSQKDTEAKELNEK
LIVLEGQIEAFKEEAHEVSTTTEKQKVELEETLLKLKHLEDVVEELQAKSSQAQKENEGL
AEANLKLAEELAAYEGKLNDLQVKFSAAVAEKDEVTEQLRSLELQLTTEGQTLKSQINSL
MEEKNLLGETYGNSKKELESLMFQLEERAKEKQTSEDTLQCEIENLKAEILEKSALQTRL
KELEEVIAKKSITEEQRARAEAETLVEREASLKESLEKLEEKSKAVVTLEQQVTELEHKL
QQAEAKLLKKDTAASEVQPQKATEIKSRDIGSPVSTPSKRKSKKKVEPSPPLASTSSPTQ
AQAHDTSPFMTFKLILGVALFSVVLGIILGKRY
Download sequence
Identical sequences A0A059DDJ2
XP_010044736.1.83385 Eucgr.A00904.1|PACid:23562616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]