SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.A02033.1|PACid:23563857 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.A02033.1|PACid:23563857
Domain Number 1 Region: 257-369
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000202
Family Ankyrin repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 44-185
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000589
Family BTB/POZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.A02033.1|PACid:23563857
Sequence length 574
Sequence
MEYENGLSSPSSYLSNGSTDHDAAVPVMNPESGYNPDLLSLTKLSDSLDKLLCDDDYGYT
DAVIVVEGVPVGVHRCLLAARSQFLHEFFKQGGGDNAREGKPRYPISDLVKKGHVGCEAF
KYVLRYMYTGKLKLFPAEVSTCVDSSCAHDVCGPAINYAVELMYASATFEIAELVMLVQR
RLLHFIGKAAVEDVIPILKVAFNFRLKELLPSCFETVARSYMDSIVLEKELPHEIYAEIK
VQRDRFGEAGEPMVTEVNPSLEKSIKQIHKALDNDDVELVRRLLNESVVTLDDAYALHYA
TAYCHPKIFKEVLGLGLADLNLKDSRGYTVLHVAARRKAPSILLPLLYKGACAMESTSDG
QTAVTICRRSTRPKDYFQETKQGQESNKDRICIDALEREMQRRISEAGYMSISPDAITDD
IYRLDYLVGRVKFAAMFFPAEAKIAMEIADAEWTSLYKGLASKSLNVDFKEVDLNEGPAF
LANGLQALRKTVEMGRRYFPHCSEVLDKFLDEAPDDFFLDQGTSEEKTSKKMRFMELKEE
FQKAISKDMAENKKSGRFPASSSSCSPRQRMKKK
Download sequence
Identical sequences A0A059DH89
Eucgr.A02033.1|PACid:23563857 XP_010054033.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]