SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.A02625.1|PACid:23564572 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.A02625.1|PACid:23564572
Domain Number 1 Region: 68-173
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.83e-32
Family B3 DNA binding domain 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.A02625.1|PACid:23564572
Sequence length 278
Sequence
MSLNHPLSTSDGTPNTLWWTTHPTMFRQHNLLLNFNPTDDDPQDEGSPPPPYVLRGAPPP
AEPSPAEKEPMFEKPLTPSDVGKLNRLVIPKQHAEKHFPLVGEATQQLSFEDESGKWWRF
RYSYWSSSQSYVLTKGWSRFVKDKRLDAGDVVLFHRDRADAERLFIGWRRRGESSPGASA
VAAETRVGGGGGGFYAGRPYPGHNDGPSQPGSYTHGQAGGAPAAGNNPRRVRLFGVNLEC
QLDGDEESELPGSSHSPTGHGLSSNSSNYTPSHGLHFI
Download sequence
Identical sequences A0A059DJE9
Eucgr.A02625.1|PACid:23564572 XP_010059417.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]