SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.B02809.1|PACid:23568030 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.B02809.1|PACid:23568030
Domain Number 1 Region: 160-227
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000687
Family B3 DNA binding domain 0.0084
Further Details:      
 
Domain Number 2 Region: 19-91
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000994
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.B02809.1|PACid:23568030
Sequence length 237
Sequence
MTSCRRRGDEENRQSFALETPHFFKIVLSQTLQIGRLSIPKRFVRKYGKNLPKTLRERIP
PALPMGGCEGHLLVFKYVENSDFHVLIFDKSASEIDYPLMNTDSKKSNLDFVKAVPPIMG
DTDDHYNISIELERLNGFSLKRKEKDKLHLIPFHHKPSKTVPGRVLKGCIDGRTQTATLK
YLERSWTVKLLYYRQHGLGKLSAGWSAFQRGTSLKEGDVCVFEPVRIDIIELEVSTF
Download sequence
Identical sequences A0A059D6R9
Eucgr.B02809.1|PACid:23568030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]