SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.B03551.1|PACid:23568902 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.B03551.1|PACid:23568902
Domain Number 1 Region: 123-260
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.88e-39
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 671-750
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000028
Family PB1 domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.B03551.1|PACid:23568902
Sequence length 787
Sequence
MASHEVSVVGSDRRERERTGCEDALYKELWHACAGPLVTVPREGELVYYFPQGHIEQIEA
SMNQVADRQIPFYNLPSKILCRVINVQLRAEPETDELFAQVTLLPVPNQDETAVEKETGH
PLPPRPRVHSFCKTLTASDTSTHGGFSVLRRHADECLPQLDMTKQPPTQELVAKDLHGNE
WRFRHIFRGQPRRHLLQSGWSLFVSSKKLVAGDAFIFLRGENGELRVGVRRAMRQLNNVP
SSIMPSHSMHIGVLATAWHAISTGTMFTVYYKPRTSPAEFIIPFDKYIESAKFDYSIGMR
FRMTFEGEEAPEQRFSGTVIGSEDVDPPRWPGSKWRCLKVRWDEITSIHRPDRVSPWNIE
PAVTAPDNLPASRPKRPRASMSSSTDSSVRMREGPLGNGTDPPADIGFSKALQGQEFSTL
KGSLTLNNDMENAEMPDAWYEFPGDNRKSMHFGQRKCRPNTWVPQLVQEATLINLVPDSG
TFHHRHGIFSSFLRRDSEITKRAKKQNSAEETKTDLIPSPGSVRQGPSLNMLGSGIVASL
ENESRQQQSLGNVKGDTKREMNSGNCFLPMHSPSLAQQELIKANGNGSCKLFGISLMSGT
VATESDNGHVHGSQKPVLQSNLVDYSEPNVLGSPIKCLKIAPSPIAYGEQGRAFPSSEQP
VRDVEGKHQAVSTRSCIKVHKQDIPVGRSVDLSRFHGYSELITELDEIFDFNGDLVAPSK
EWLVVFTDDEGDMMLVGDDPWEEFCGMVHKIFIYSREEVKRMAPRPLVPKSEEISPKTSH
KRYSGGI
Download sequence
Identical sequences A0A059D8V3
XP_010044876.1.83385 Eucgr.B03551.1|PACid:23568902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]