SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.B04027.1|PACid:23569481 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.B04027.1|PACid:23569481
Domain Number 1 Region: 292-395
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-19
Family B3 DNA binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.B04027.1|PACid:23569481
Sequence length 861
Sequence
MGSSICMNESCGTPCPEWTTGWPLRSGGLARLCLQCGSAYEKSSYCDCFHQEESGWRDCR
FCGKRLHCGCIASRSLVEFVDCGGVMCISCSKNRTHPSTSTEDRGREEEKLMQLFMSNEP
KILPQAPRDDIRASYGEVQQETRHFSGEAAIGFSHGMTDPTVGSRKLTKLEDSRFLLKLK
DTHRSLPHPSLNISLGSPGVSSHIAPPFSGRVGEGSQTVGPPSLLQGRSRPILPKLPKSA
IAGPETIKIPHVRVARPPAEGRGKNQLLPRYWPKITDQELQQLSGDLNSTIVPLFEKVLS
ASDAGRIGRLVLPKACAEAYFPAIAQSEGIPVPIRDVKGNEWTFQFRFWPNNNSRMYVLE
GVTPCIQSMQLRAGDTVIFSKIDPGGKLIMGFRKASNSNDPQDNQVPIVPNGDLSREGSF
QPFMGTLPIVEDYTNLFRTASGIKDPRSNPSSELLSNNDGDTRCNKMEDDVGRTCEDPAQ
QASPIPEKKRTRNIGSKSRRMLIHNEDVLELRLTWEEAQDLLRPPPCVKPSIVTVEGHIF
EEYDEPPVFGKRTIFVSQLSGGTEQWAQCDDCSKWRKLPMDAHLPPGWICSDNIWDSERR
NCSAPDELSPEELESLLRVNKDVKRQRVDEDHRNETDGETSGLDALASAAVLGESMDDPG
EPSSGVTTKHPRHRPGCTCIVCIQPPSGKGKHKPTCTCNVCMMVKRRFKTLMSRKKKRQS
DQDSETIQKDLIHYGHELGTDGTLVNASSEINHEENVISQNKKTEVADNSNGHIDLNCHP
DHEHVQLEGETRSIMGFTQETKNLSGNDSTHDVISTLQCERLASTSSGLFGQTVEEKGKR
LSNGECLQSILHETMMQAKKG
Download sequence
Identical sequences Eucgr.B04027.1|PACid:23569481 XP_010045426.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]