SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.C02178.1|PACid:23571667 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.C02178.1|PACid:23571667
Domain Number 1 Region: 126-266
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.45e-43
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 1018-1085
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000108
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.C02178.1|PACid:23571667
Sequence length 1119
Sequence
MKMPASGAGAPSATATASPCEGGGEKKSVINPELWQACAGPLVNLPPAGTHVVYFPQGHS
EQVAASMKKDVDAQVPNYPNLPSKLLCLLHSVTLHADPETDEVFAQMTLQPVPSFDKEAL
LRSDLALKTTKPQPDFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQELMAR
DLHDTMWNFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVLFIRDDKQQLLLGIRRANR
QPTNLSSSVLSSDSMHIGILAAAAHAAANNSPFTVFYNPSCFALRASPSEFVIPLAKYYK
AVYSNQISLGMRFRMMFETEDSGTRRFMGTITGMSDIDPVRWKDSQWRNLQVGWDESTAG
EKRTRVSSWEIEPVTAPFFICPPPFFRSKRPRQPGMPDDDLSDLDSLFKRTTMPWLVDDL
SMKDPPALSGLGFMHWMSMQQSPSFANSIQSNYMPNLSNSVLQNLSGTDPSRQLGFSAPQ
MAQLNNLQFNTQRPPQQAQQLDQLTKLPSTLNPLSNIVQPQQQLTDISQQSRQSLINHTL
PSTQVQAQVLQSQSLIQSSTLLPQQSLNQNQPFHRSLPQNLHQPQQQQIMGQNQQQSALN
SQMPDQSSSQLPMPDNQIQLQMIQKLQQQQQQQQSLLAQQSALQQPTHPQQLQEQRQHPD
VSQSFSKSMVTSQMLEMPQSTANSFSQPNIIPQQIQKNNSQLNVRFSNLSQQPKFQQEQS
GLLPEMVGHMGLPQISTSHASASASMLTGAAAGGPSVTTDDMPCSASASGQNCANIVQSM
MNGRPHRSASISEDMSQSTATFWNPSALETIGSNGNNMMKDFQPKPDVKPSLDVSKGQNQ
GFFSAQTYLNGATTQTDYLDASSSTTSVCLSQSDAHIQQNNSSVSYNQQSMLFRDTSQDR
EVQADIRSSVPFSSNADVQAGIPVNSDSMFGKGMVGLGKGFANDVPSAGILADYDNKEPQ
QLSSSMVSQSFGVSDVAFNLMESALNESTLVSRGPWGPAAPQFQRMRTFTKVYKRGAVGR
SVDITRYSGYDELKQDLARRFGIEGQLEDGQKVGWKLVYVDHENDVLLVGDDPWEDFVNC
VRCIKILSPQEVQQMSLDGDFGNTTLPNQACSSSDGGNV
Download sequence
Identical sequences A0A059CR05
XP_010048533.1.83385 Eucgr.C02178.1|PACid:23571667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]