SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.C03293.2|PACid:23572725 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.C03293.2|PACid:23572725
Domain Number 1 Region: 116-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-44
Family B3 DNA binding domain 0.0059
Further Details:      
 
Domain Number 2 Region: 1012-1075
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000141
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.C03293.2|PACid:23572725
Sequence length 1118
Sequence
MKVPSNGFLAGGGEGEKKSINSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKE
TTCVPSYPNLPPKLICMLHNVTLHADLETDEVYAQMTLQPVSKYDQEALLASDMGLKQSR
QPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPSLDFTMQPPCQELTARDLHDNSWTFRH
IYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDEKSQLLLGIRRANRQQPALSSSVIS
SDSMHIGILAAAAHAAANNSPFTIFYNPRASPSEFVIPLAKYNKAFYTQVSLGMRFRMMF
ETEESGVRRYMGTITGISDLDSVRWKNSQWRNLQVGWDESTAGERPSRVSMWEIEPVVTP
FYICPPPFFRPKFPRQPDDESDVENAFKRAMPWLGDEFGIKDTPSSIFPGLSLMQWMSMQ
QSNPLQATQSGLLPPMLSSTGLHNNLGIDDPSKLLSFQAPTQGLQFNKTNPQNQVSQLLQ
PSMAWSQQHQLQQLLQNPLGHQQQQQQQQLQRQQQQQLQSSQQQTPQQLPQSQPPQQQPL
QPQQFQQQSPHQPSQQTSQQQQVVQTPLGNGGVVTSNQFPSQMVQQSALYSQLQQQQQQQ
QQQLLTTQNAPSQPSILGINKVPVHPTSVSQDSKFQSQMEQQQPSLLQRHQQQPMQMQPS
SLLQQSWTQRAQPQLQPQLPQVLQQNLSEQQIQLQLQKLQQQQQHQQQLPNPAGPLLQPQ
LQQQQQQQQQHQQQVVPQNQMPLSQQQLVCNSLPTPALLPPQPSNPNHLYGQQKALTAVR
ALSGLTDGDGPSCSTSPSTNNCHIPSSNFLCKNQVAQPVLVGDSSLIEPMNHLIQEHQMK
PDARIKHELPSSKGHDQLKYKASVTDPLEVSSSATSYCLDATAAQQNFSLPTFCLDSDVQ
SQPRNTSPFAANIDNLAADTLLSRGFDSQKDLQNLLSTYGGGTPRDIETELSTAAISSQS
FGVPSMPFKAGCSNDVAINDTGVLNGGIWSSQTQRMRTYTKVQKRGSVGRSIDITRYRGY
DELRRDLARMFGIEGQLEDPHRTDWKLVYMDHENDILLVGDDPWEEFVTCVQSVKILSST
EVQQMSLDGDLGLVPIPNQASSGTDSGNAWRGDILISR
Download sequence
Identical sequences A0A059CVH0
Eucgr.C03293.2|PACid:23572725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]