SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.D00053.1|PACid:23573847 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.D00053.1|PACid:23573847
Domain Number 1 Region: 182-289
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.93e-29
Family B3 DNA binding domain 0.0000225
Further Details:      
 
Domain Number 2 Region: 63-120
Classification Level Classification E-value
Superfamily DNA-binding domain 9.81e-17
Family GCC-box binding domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.D00053.1|PACid:23573847
Sequence length 327
Sequence
MDGNIICIDELSSTSDSNVTPLPSKSWQPPTPPQSLCRLGSGTSVTLDCEGGIKAESRKL
NPSKYKGVVPQPNGRWGAQIYEKHQRVWIGTFSEEDEAAMAYDIAAKRFRGQEAVTNFNQ
SRFPDFSFQAEIVDMLRKHVYYEELEQCKRKYVNANGDGKRMSMTEALGDPSGPGRAVAA
CHLLFQKEVTRSDVGKLNRFVIPKQHAEKHFPLHNRSSPTTPKGTLLNFIDGGGKVWRFR
YLYWNSSHSYVLTLGWSRFVKEKSLRAGDIISFHQSAGPEKQFHINYMRRSGLSQARPVH
PVQKVRLFGVDIFQVSGTGGGVNCGGR
Download sequence
Identical sequences A0A059CBR5
Eucgr.D00053.1|PACid:23573847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]