SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.D00268.3|PACid:23574034 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.D00268.3|PACid:23574034
Domain Number 1 Region: 25-124
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.55e-24
Family B3 DNA binding domain 0.0018
Further Details:      
 
Domain Number 2 Region: 192-291
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.45e-23
Family B3 DNA binding domain 0.0043
Further Details:      
 
Domain Number 3 Region: 328-423
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000765
Family B3 DNA binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.D00268.3|PACid:23574034
Sequence length 433
Sequence
MGRRSRHRRRREGGGAEPEMDPGSPPSSPHFFKIVLSRALESGKLGIPKSFLRRYGKDLS
GLVLLKVPGGSTWPVKLEKSDDGKVWLWKGWRGFMEHYSIGHGHLLVFKYEGDSVFHVII
FDKSASEIDYPSSIESDMSSPEEEFLSRKEEDVVEIKDSEGSVPCSQPSSYRSSREYGVP
SHLAAFELASEFKSDHPFFKVVIQPTYVRKSLTIPREFFIKHVQKNKQIATLRYSDRSWQ
VKLRTHEHTACLSTGWSSFARENDLLVGDCCVFELIDRDDIVFRVSIFRSDGQIQTEQSQ
CQEHPSESAFHTSPCLSPVIAHERACEFESEYPFCNVVISPSHIKRQTVFIKTYIQKDHQ
MVNVVYLGRSFEVNLRVYRHLYIAFLGVGWSALAREAHLRKGDVCMFELLDRDNIVLRVS
VFSSANKEVICIE
Download sequence
Identical sequences A0A059CD82
Eucgr.D00268.3|PACid:23574034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]