SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.D00588.1|PACid:23574345 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.D00588.1|PACid:23574345
Domain Number 1 Region: 153-266
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-42
Family B3 DNA binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.D00588.1|PACid:23574345
Sequence length 723
Sequence
MIDLNTVEDDETPSSGSSPASSLSSAISASNINSNPAYPTSSSSSSSSCSPLCLELWHAC
AGPLISLPKRGSLVVYFPQGHLEHVSDFPTSVFDLPSQIFCRVVDVKLHADASTDDVYAQ
VSLVPEREQIEHKLREGDNEIDLDEDEIEPAVKSSTPHMFCKTLTASDTSTHGGFSVPRR
AAEDCFPPLDYNQQRPSQELVAKDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNRKKLVS
GDAVLFLRASNGELRLGVRRAIQVKGASAFPSLCIQTLNQSALMDVPKAVSLGIAFSVYY
DPRASSSEFLIPARRFFKSLNQTLAPGMRFKMRFEAEDTAERRHSGLIANISDMDPVRWP
NSKWRCLSVRWDDVEPDRGSRICPWEIEPSGSVSSPIGFMMPGSKRTRFGIPSMKPEYPV
PNGIGASDFGESFRFQKVLQGQENLGFGTPYDGIETQSHRLSEVRRHHPDDSGGSEAAAT
RNGITNPSVNASVTYKGMGFGESFRFREVLQGQETFANPPYTRPWFTSGAQGNGAFGVRD
GFQMVPSRNGCSALSQGSDNRFGLPVSSVQVSSPSSVLMFHQPSRKSSNRSSLCNTLPWD
EKLSSPMKVSFGGTSPLGLLNEENRLSFPHSSILLPSEGVVSEDMAPPLKSSCRLFGISL
TEGRDVSHKEVSMSSSRLNGEPLFGHIGENFHPKANVSRVVGSNCTRVLDLPPVSDVLFD
VAS
Download sequence
Identical sequences A0A059CE30
XP_010052260.1.83385 Eucgr.D00588.1|PACid:23574345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]