SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.D01619.1|PACid:23575370 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.D01619.1|PACid:23575370
Domain Number 1 Region: 59-254
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 9.35e-43
Family FAD-linked oxidases, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.D01619.1|PACid:23575370
Sequence length 538
Sequence
MAFRSSLLLSQILFLFVALPSSWTSATSTIQQTFFRCLSTNSMNSIPLSTYYTPNNVTSF
TSVLNSTANNLRYLLPNAPKPVIIFTPLCEAHVQAAVLCSRRFGLALRVRSGGHDYEAVS
YVSQIESPFLVLDLARLRSIQVDIRRGTAWAQAGATTGEVYYRIAQQSRVHGFPMGLCAS
LGVGGHITGGAYGSMMRMFGLGVDNVIDVRMVDSKGRILDRKAMGEDLFWALRGGGGGSF
GVILAWNLKLVNVPETVTVFTVTKTLEQGATKLLYKWQKVAPKIDDRLYIRVIIQASSAD
LTANRTVVTSYNALFLGDPDTLLRIMGKRFPELGLTRADCVKTSWIGSVLYIAGYPNTTA
PEVLLQGKPLFRNYFKAKSDFVRTPISVKGLLGLWKIYLQEENPFMIWNPYGGAMARVPE
SATPFPHRYGTLFKIQYVATWQDGTQSMARHMNWLTKLYNYMGSYVSKNPREAYVNYRDL
DLGMNKKGVNSLAEASSWGLRYFKSNFYRLVQVKTRVDPDNFFRHEQSIPPLPVKRGR
Download sequence
Identical sequences A0A059CFL2
Eucgr.D01619.1|PACid:23575370 XP_010053022.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]