SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.E00888.1|PACid:23577618 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.E00888.1|PACid:23577618
Domain Number 1 Region: 113-251
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.79e-40
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 566-651
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000108
Family PB1 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.E00888.1|PACid:23577618
Sequence length 687
Sequence
MMMNRAEGRGGGGGDDLYTELWKACAGPLVDVPRHGDRVYYFPQGHMEQLEASTNQELNQ
RIPLFNLTSKILCQVVNVQLLAEQETDEVYAQITLIPAGNLMEPTSPDPVSAETPRTRVH
SFCKVLTASDTSTHGGFSVLRKHATECLPPLDMKQATPTQELVAKDLHGYEWKFKHIFRG
QPRRHLLTTGWSTFVTSKRLVAGDSFVFLRGDNGELRVGVKRVARQQSSMPSSVISSQSM
HLGVLATASHAVTTQTLFVVYYKPRTSQFIISLNKYLEALNNKFTVGMRFKMRFEGEDSP
ERRFSGTIVGVEDFSPQWDNSSWRSLKVHWDEHASIPRPDRVSPWEIEPFVASVPANIPQ
STTKNKRPRPSSEVPADATAAPAIWNSGYTQTHDLKQLRVTDEGKSSDHFMWNYKMADVN
SSSSSITRVQTEGGWLPSPCLSVSPNILPDAVDDSKSVSALPVPCRHPIAHPSSLNNELM
PNPAEDGKKVEPTSSCRLFGIDLINHTLSSPPSDKGPFQSMCVSTATTEGHVQMALSTAD
SDQKCDIQKASEEVKQRQMQNLGKEGQTKQICSTRSRTKVQMQGMAVGRAVDLTMLEGYS
QLMNELEEMFDLKGQLQSRDKWEIVFTDDEGDMMLMGDDPWPEFCNMVRRIFICSSQDVK
KMSAKSKLPVSSVQEEGTVISSESADN
Download sequence
Identical sequences A0A059C275
Eucgr.E00888.1|PACid:23577618 XP_010055888.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]