SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.E02529.1|PACid:23579054 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.E02529.1|PACid:23579054
Domain Number 1 Region: 24-82
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000942
Family B3/B4 domain of PheRS, PheT 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.E02529.1|PACid:23579054
Sequence length 131
Sequence
MEFYKSDLKLKKFLHIIENSLVFPIIYDSKRTVLSLPPIINGAHSAITLKTKNVLIECTA
TDLTKAKIVLNTMVTIFSAYCGKKYEVEPVEVIYSSGESFVYPDLSLYNMEVSLSYVNNS
IGVALKAEEVL
Download sequence
Identical sequences A0A059C681
Eucgr.E02529.1|PACid:23579054 XP_018728510.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]