SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.E03467.1|PACid:23579815 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.E03467.1|PACid:23579815
Domain Number 1 Region: 147-245
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000419
Family B3 DNA binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.E03467.1|PACid:23579815
Sequence length 315
Sequence
MDDFSDRPMNKKIKLGPDEELENGIAGPNSDDHLNPCEINPQQSTSEKEDPSTPPCGLAV
PHASGDEPNGHIGLVGPHFRPAPPPTIAKHFYGSTLSDTNSSGESRTRNGRPRGDARGRS
QLLPRYWPRITDQELQQISGDSNSVITPLFEQTLSASDAGEIERIVVPKKCAEAHFPSIS
QPEGLPLKVQNAKGLEWIFQFKFQPNNNSRTYFLEGVTPCIQSMQLQAGDIVTFSRLEPE
GKLVMRPSTAPPSDQKGRDGEEPREEEDASISEQRPEQQLGESFEQSDAHLQGNMRKGGA
EAEAGEEDVEEANTI
Download sequence
Identical sequences A0A059C912
Eucgr.E03467.1|PACid:23579815 XP_010057548.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]