SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.F02399.2|PACid:23583201 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.F02399.2|PACid:23583201
Domain Number 1 Region: 237-338
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.14e-23
Family B3 DNA binding domain 0.0059
Further Details:      
 
Domain Number 2 Region: 459-559
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.94e-23
Family B3 DNA binding domain 0.0088
Further Details:      
 
Domain Number 3 Region: 12-111
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.61e-23
Family B3 DNA binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F02399.2|PACid:23583201
Sequence length 585
Sequence
MERDETRWKMPNGKRPHFFEIYSSSVSSRRLKIPDKFVKHMEGWMSGLALLEGPSGNTWH
VELIEENHELFLNSGWHSFIRDHSIVSGDLLVFRHDGNLHFYVQVFEQSSCEKEAAFHAM
CSQDPSSCRQNGERNGERNEITYCSNIVYESHKPKVCACDDKLGRKQDAVTSAQHRGTSI
VRETPHDNIILSSKAQVYEESPDIRNRFSKGDHSSLSTSCHMLKSLSEEERKVARSFSSH
FPYFVRIMKKFNISGSYTLNIPYQFSMEHLPVSKITIVLRNLKGESWTVNSVPTTRVHTS
HTFCGGWMAFVRANGIELEDVCVFELVRKCEMRVHILGAAQGRPDCQSVKKTLTWLDVRN
TATLNAGRENVSKKRKRKSTKVSSQIVEKVKRMLQEASSSDMKKHAGAFKGSSNALKTSN
GKSAIIVGASTGTARSSQNTDCLSVMLSLQEERVARSFASSFPKFVRIMKRFNVSGSYTL
KIPHQFSMDHLPICKTEIVLRNLEGESWTVNSVPDSKGRMLHTFCGGWLSFVRGNGIKIG
DTCIFELVGKLEMRVHISEDGNKEQAQQHGKVDGVLVPLAASVDN
Download sequence
Identical sequences A0A059BRQ9
Eucgr.F02399.1|PACid:23583200 Eucgr.F02399.2|PACid:23583201 XP_010061801.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]