SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.F02719.1|PACid:23583594 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.F02719.1|PACid:23583594
Domain Number 1 Region: 236-626
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.66e-94
Family Regulator of chromosome condensation RCC1 0.0011
Further Details:      
 
Domain Number 2 Region: 13-123
Classification Level Classification E-value
Superfamily PH domain-like 2.13e-26
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 
Domain Number 3 Region: 625-695
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.58e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F02719.1|PACid:23583594
Sequence length 1129
Sequence
MADLASYGNADRDVEQALIALKKGAQLLKYGRKGKPKFCPFRLSSDESSLIWVSSSGEKS
LKLASVSRIIPGQRTAVFRRYLRPEKDYLSFSLIYKNGKRSLDLICKDKVEAEVWIAGLK
ALISTGQGGRSKIDGRGDGSLYLDDSRDLTSNSQSDSSASATQDISSPDVSLSSNPNSSP
KTFHTENSFHFDRSHVASDNTNMQVKGSNSDVFRVSVSSAPSTSSHGSAPDDCDALGDVY
IWGEVICDSIVRVDASKNSSFVTTRADVLVPRPLESNVVLDVHHIASGVRHAALVTKQGE
LFTWGEESGGRLGHGVGRDVTHPRLVESLAFANVDFVACGEFHSCAVTVTGELYTWGDGT
HNAGLLGHGTDVSHWIPKRVSGPLEGLQVASVTCGPWHTALITSSGQLFTFGDGTFGALG
HGDRENVSYPREVDSLRGLRTIAVACGVWHTAAVVEVIVTQSSAAVSSGKLFTWGDGDKN
RLGHGDKEPRLKPTCVPALIDYNFYKIACGHSITVGLATSGHVFTMGSTVCGQLGNPQSD
GKVPSIVEDKLLGETVEEIACGSYHVAVLTARNEVYTWGKGANGRLGHGDLEDRKTPTLV
EALKDRHVKYISCGSNYTAAICLHKWVSGAEQSQCAACRQAFGFTRKRHNCYNCGLVHCH
SCSSRKAFRAALAPNPSKPYRVCDSCYAKLSKVLEGSVNNRRNSVPRLSGENKDRLDKAD
LRLSKASVPSNMDLIKQLDSKAAKQGRKADTFSLVHSTQAPPFLQLRDAVLSTATELRRS
APKPVHTPSGVSSRSVSPFSRRPSPPRSATPVPTTSGLSFSKSITDSLKKTNELLNQEVI
KLRSQVESLRQRCEHQELELQRSTKKAQEAMSLATEESAKSRAAKEVIKSLTAQLKEMAE
RLPPGVYDAESVIQTCLPNGLEFNGFCHPDANSECHSRSDSFISSFMGSSAANDSALATG
IQNLSRSPGTLFPASETNMHQQNQSSLASSKTDDPHDVRLPNGEQGNQATNGNGTEVFHG
GESRPSQSGESGIGSENSALTSNIVQVEAEWIEQYEPGVYITLVALRDGTRDLKRVRFSR
RRFGEHQAETWWSENREKVYEKYNVRVSERSSASSQAARRSEGSMTPTC
Download sequence
Identical sequences A0A059BSW2
Eucgr.F02719.1|PACid:23583594 XP_010062134.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]