SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.F02909.1|PACid:23583834 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.F02909.1|PACid:23583834
Domain Number 1 Region: 164-493
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.59e-72
Family Regulator of chromosome condensation RCC1 0.00068
Further Details:      
 
Domain Number 2 Region: 497-560
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000245
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 3-84
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000169
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.F02909.1|PACid:23583834
Sequence length 885
Sequence
MRVLFQDEKFMIWYSGQEEKQLRLSSVTEVIRGQRTVNFQKQLQPDREAQSFSLIYADGK
RSIDLICKDHAQADSWYLGLKTIISKCQHSRPFASFRSPSGVQTCVNSPAGFMRRKYNLG
LLEDTAGFCQVRSLCGSPALSLSKRYFSEGSSNSSDSFYSSESSTSQDIFIWGEGAGGAL
RGVVDKSVDNTGMLRDSLFPRLLESAMMLDVEQISLGGKHAALVTKQGEVFCWGEADKGK
LGHKVNMDESCPKLVESLSMVHVKSVTSGEHQTCAVTLSGDLYAWGDYNIGSDLAVEERS
RNQWLPCKISGPPNGIKVSSVSCGIWHTAIITTSRQLYTFGDGTFGVLGHGDLRSISWPK
EVESFRGSRVKSVACGHWHTAAIVEVVSDRLSPSGVSGKLFTWGDGDRGRLGHGDQEKRL
LPTCVAKLVDHDFVQVSCGRTFTVALTKLGKVHTLGLGNTEDRGSPTLVEALCNRIVESI
SCGSNTTAAICIHKFVSVGDQTACSRCRVPFGFTRRKHNCYNCGLLICHTCSSNKVKNAS
LAPNRNKPSRVCDPCFVKLKIDTCSNSEKDVQKQLRPCGKVSQFSEMQILPDKKEGHEDL
DFVPSLLTRTPQWGQVSRPTCFECSMELAPLPKTQALTISPIHSLTRPPGSKLSIKTATN
TQEVKPESAKMLSEEMHRLINQARTLEEQCSIRNQKIKECQRKLEETRSLAREEAAKCKV
ANEVIKALAVQLHKLSTKASVGSGTKDGVDEQMPQNAPSLGELNVMKGRQTNSSCGSPTA
LTDASKPLYKKDEWRDGSKLAHSHPARKEVQPNVAKDVGLEWIEQYELGIYLTFTALPNG
QKGLKRVRFSRKHFSEKEAERWWEEHQVAVYEKYDLEGYMKSSRK
Download sequence
Identical sequences A0A059BTP1
Eucgr.F02909.1|PACid:23583834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]