SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.G00889.1|PACid:23586516 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.G00889.1|PACid:23586516
Domain Number 1 Region: 127-229
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-21
Family B3 DNA binding domain 0.0062
Further Details:      
 
Weak hits

Sequence:  Eucgr.G00889.1|PACid:23586516
Domain Number - Region: 264-311
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00151
Family B3 DNA binding domain 0.022
Further Details:      
 
Domain Number - Region: 3-37
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00746
Family B3 DNA binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Eucgr.G00889.1|PACid:23586516
Sequence length 391
Sequence
MQHYSIGHGHLIVFKYKGSSTFRVMIFNKSSSEIDYSSSSISNLGSGFISPEWEDVIEME
DSEDSASHQKMRVEPHSPCSQLSPSCSSQDLEDGAGQSRSRASHSKPVSGGSMSPWPLSS
FELASKFDSEYPFFKVVMRPSYMKKEAYVPRRFIIQHILEIKEIVTLRHSGRSWPVKLWS
NPRSVHGAAFSSGWGAFVRGTRLHVGNVCVFELIDRDDIVFRVYIFSSKGTCKQSKCRVN
HLEPVFHDPAPPRPLTTPELARDFDSEHPFFKLVIRECHLKTLSVPDRFIRQHIRENKGT
ATLRYSDRSWPEMPACLSSSIGKIMCSKSPSSATAVRTRFTLIEVITGHVTIGCLQRRCK
SRISNYASSIQQWQIDETETLFCSWFLVFWW
Download sequence
Identical sequences A0A059BC57
Eucgr.G00889.1|PACid:23586516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]