SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.G01245.1|PACid:23586859 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.G01245.1|PACid:23586859
Domain Number 1 Region: 225-330
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-22
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 30-126
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-21
Family B3 DNA binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.G01245.1|PACid:23586859
Sequence length 339
Sequence
MASCSRRRRRRRREDGAVEPEVVAGRCRESRCFFKIILSDTLESGKLGIPKSFLRRCGKD
LSNSVLLQVPGGSTWTIELEKCNNDMVSLWKGWQDFMEYYSIGHGHLIVFKYIGNSTFGI
IIFDKSTSEIDYSLSSGKKTDLGSKFPSPKTEDVVEAEDPEELITRRKMRVESHLPYSQL
SPIYSPRGSKDGIRRSRCKMNHSEPFFGGPTCIGPLSGFELASEFESEYPFFKVMMQPSY
LKHHILYVPRRFIMQHIRKIKEIAILRHSGRYLDRSWPLKLLRYKQDHKAFFSGGWPAFA
RENCLHVGDVCMFELIDREDFVFEVSIFCSAGTGPILTD
Download sequence
Identical sequences A0A059BBK8
Eucgr.G01245.1|PACid:23586859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]