SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.G02511.1|PACid:23588148 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.G02511.1|PACid:23588148
Domain Number 1 Region: 248-535
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.37e-70
Family Regulator of chromosome condensation RCC1 0.022
Further Details:      
 
Domain Number 2 Region: 14-122
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-26
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 
Domain Number 3 Region: 536-609
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.02e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  Eucgr.G02511.1|PACid:23588148
Domain Number - Region: 739-809
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0178
Family Seryl-tRNA synthetase (SerRS) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.G02511.1|PACid:23588148
Sequence length 927
Sequence
MADPQKSGLTTERDIEQAITALKKGAYLLKYGRRGKPKFCPFHLASDESTLIWYSGKEPK
QVKLNQVSKIIPGQRTAIFQRYPRPEKEYQSFSLICSDRSLDLICKDKDEAEVWLVGLKA
LITRGNFRKWRSDTISETASAESPLARRNSPSITLLDPGHIYGIQPPLESTSQTRLGKVF
SDIISYTAADTGYNRNEPIANSLNSVSPGGGDNWNGRNSGAETFRISLSSAVSSSSQGSC
REDFESLGDAFIWGEGIGGGILGGGQQRFGSPYNTKTDAFLPKALESTVVLDVLNIACGY
RHAVLVTRQGEIFSWGEELGGRLGHGIESDISHPKLIDSLSGMTIESVACGEYHTCAATL
SGDLYTWGDGAHNVADPASGRLFTWGDGDKHRLGHGDQETRLIPKRVAALSGETICRVAC
GHSLTVALTASGRVFTMGSTAYGQLGNPLADGKAPTCVEGKLADCFVEEIACGTYHVAAL
TSKGEVYTWGKGSNGQLGHGEYDNRSTPTLVGFLKDKQVKSVVCGSNFTAVICLHKWVSS
IDHSMCSGCQNPFGFRRKRHNCYNCGLVFCKACSSRRSLKASLAPNLNKPYRVCDECYVK
LKTTTESGPVLRIPKARTDTLRLKNNEVGEKDSSCSTSEGRLCRLLSADSLSLAESRHSI
HDAKVGSRGSRVFPLLNRNFQPGGLNTTKEPILVGAPTKMFSFSVPGSRMPSRSASPLSR
KSSPPRSSEVTTDDSKHSSDSQSQEIINLRAQVEDLTSKSRNLQSELEKTSKQLKQVTAI
AEDEARRCKSAKEVIKSLTTQLKEMAERLPVGQRAQSSGSVIRELSGDPNLIHNENQSAK
SNFLENESHFKSVNTTLLNGMKQQPEKAEWVVQDEPGVYISLASLPRGGNELRRIRFSRK
QFTEEQAEKWWAANAAMVLERHNIQST
Download sequence
Identical sequences A0A059BFV3
Eucgr.G02511.1|PACid:23588148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]