SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.G02838.1|PACid:23588588 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.G02838.1|PACid:23588588
Domain Number 1 Region: 128-235
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-30
Family B3 DNA binding domain 0.0017
Further Details:      
 
Weak hits

Sequence:  Eucgr.G02838.1|PACid:23588588
Domain Number - Region: 612-683
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0106
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.G02838.1|PACid:23588588
Sequence length 692
Sequence
MVELALDRFMISVMDSRKESLKRNPQKCLDSQLWHACAGGMVQMPPVNSKVFYFPQGHAE
HAQGTVDFGTSQIPPLILCRLAAIKYMADPENDEVYAKITLMPMRSDEYHHLDDDGSLGK
DGTENLEKVASFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSAEPPVQTIVAKDVHGE
SWKFRHIYRGTPRRHLLTTGWGNFVNQKKLVAGDSIVFLRAENGDLCVGIRRAKRGIGIG
GNDNACGWNSASGNFGGYSMFAREEGSNLMQKGCGGEFRRKVTGESVLQAATLAAKGQPF
EVVYYPRAGTPEFFVRASSVSTAMQVQWCSGMRFKMPFETEDASRISWFMGTISSVQVAD
PIHWPSSPWRILQVSWDEPDLLQNVKSVSPWLVELVSNMPSIHLSHFSPPRKKLRTPPNF
PILDQIPVPPFPSNPLGPNSPLCFIPDNIPAGIQGARHAQFLRSSSDLRLNQLHSGLFPV
GSHPLNHTSVSTRFSRGAFFGAPEDNNNSISCLLRMGTSENSSKENFEKKSPHILLFGQL
ILVDQQNSESSSGDTTGRCSSEGNQERMSNSSEGSRNNVLYYNGTVESSSDDGFTGIRRD
RASDLDLGTGHCKVFMESENVGRTLDLSVLGSYDELYRNLRDMFGINGSERLSKVLYSDA
AGAIKNAGDEPFSDFLKTAKRLTIPAGYAMKI
Download sequence
Identical sequences A0A059BIB7
Eucgr.G02838.1|PACid:23588588 XP_010067307.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]