SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.H00152.1|PACid:23589494 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.H00152.1|PACid:23589494
Domain Number 1 Region: 199-585
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.02e-97
Family Regulator of chromosome condensation RCC1 0.00055
Further Details:      
 
Domain Number 2 Region: 584-657
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.39e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0017
Further Details:      
 
Domain Number 3 Region: 14-77
Classification Level Classification E-value
Superfamily PH domain-like 0.000000541
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Weak hits

Sequence:  Eucgr.H00152.1|PACid:23589494
Domain Number - Region: 784-865
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H00152.1|PACid:23589494
Sequence length 1046
Sequence
MVQLDLIWLISISYKFLKDETTLIWYSHGEERTLKLASVSRIIPGQRTAVFRRYLRPEKD
YLSFSLLYNNGERSLDLSFTLNYDIKVTSFYHIQLSFESNGDTYAYVVDHRFLHNGGELG
PSGRPFGATFECTSSITRGRVSIDLNPRESSVSLASSDVGSERANMQLRTSAGDGFRISV
SSTPSCSSGGSGQDDIESLGDVYVWGEIWSDGPDHGSTSSPRKIDVLTPRPLESNVVLDV
HQIACGTRHVALVTRQGEVFTWGEESGGRLGHGSERDFSRPHLVEFLAVTNVDSIACGEY
HTCAVSISGDLFSWGDGTHNAGLLGHSTHVSHWLPKRVSGIMEGVQVLSVACGSWHTALA
TSAGKLYTFGDGTFGVLGHGDRETVPYPREVQQLSGLKTIKVACGVWHTAAIVEVMMSQS
SGGNISSRKLFTWGDGDKYRLGHGNKDTYLLPTCVSALIDYNFHQLACGHTMTIALTTSG
HVFTMGSTSYGQLGNPNSEGKLPCLVQDKLVGEFVEEISCGAFHVAVLTSRSEVYTWGRG
ANGRLGHGDVDDRKIPTMVEALRDRHVKNISCGSNFTASICIHKWVSGADQSVCTGCRQA
FGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYAKLKTAESGNMSYM
KGKANTMRQSIDTWEKMDRGSVKSSRILLSPTIEPVKYIEVKPGKPGAKAEPSVRRASQV
PSLLQLKDIAFPSSLSALQSALKPVATSHTPPQSAPNSRSASPYSRRPSPPRSTTPVFSR
SVVDSLSKTNEYLNQEITKLHNQVRTLKQRCDFQDMEMKKLHKDAKGAALKAAQESAQCT
KAREVINSVATQLKEIMENLPPESHNDEKFSMLYAQVETFLHTEAMPENSSSLSVNVDSD
RHRLSMDQADTVGMNDSLNENQTGTNEDSVASSMQGAIPQQNTENTSNSNPSSVTRKDGL
SQMIEQFEPGVYITVDALPNGVKAFKRVRFSKRRFAEQQAEEWWNNNKDRVFKKYPPLVT
SISHAGTSSNPLNAGESNDAAQSSEY
Download sequence
Identical sequences Eucgr.H00152.1|PACid:23589494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]