SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Eucgr.H01965.1|PACid:23591351 from Eucalyptus grandis v201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Eucgr.H01965.1|PACid:23591351
Domain Number 1 Region: 7-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-25
Family B3 DNA binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 155-262
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.94e-22
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Eucgr.H01965.1|PACid:23591351
Sequence length 281
Sequence
MVGRGYFESQTPHFFKIVLSDALQNGRLGIPKKFVRKYGSSLSDLVFLHLASGDVWEVEL
LRGNDGAFLRRGWPDFVKHYAIEHGHFLVFRYEGGSAFRVVIFDKSATEIKYPLVSENDD
PRMEEDVGDASVEVFEDHSDQVSEKSEALERATSFQSPNPFFLAIMQPSFIRHCLSAPAR
FFMKYIPNFRSKGDIILYVSDERFWSVRYKFGIYGRRRQIKFNCGWKRFVQDNNLKLGDV
CVFEIMWKVHQISFRVLIFRANGDTVEFGRGHLHVKLCFIR
Download sequence
Identical sequences A0A059B061
Eucgr.H01965.1|PACid:23591351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]